PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G348200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 295aa    MW: 32456.8 Da    PI: 6.124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G348200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-173683148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT +Ed+ lv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Sevir.3G348200.1.p 36 RGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYL 83
                        89********************************************97 PP

2Myb_DNA-binding57.14.2e-1889132146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg++T++E++l++d+++++G++ W++Ia++++ gRt++++k++w++
  Sevir.3G348200.1.p  89 RGNFTADEQLLILDLHTRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 132
                         89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.173183IPR017930Myb domain
SuperFamilySSF466896.36E-3034130IPR009057Homeodomain-like
SMARTSM007171.3E-143585IPR001005SANT/Myb domain
PfamPF002498.5E-163683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-223790IPR009057Homeodomain-like
CDDcd001674.12E-113883No hitNo description
PROSITE profilePS5129423.5884138IPR017930Myb domain
SMARTSM007173.5E-1588136IPR001005SANT/Myb domain
PfamPF002491.0E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2491137IPR009057Homeodomain-like
CDDcd001671.45E-1191132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAASQRSRSS ACSPGAPVEL DDDHGGAPEQ ADQLRRGPWT VDEDLTLVNY IADHGEGRWN  60
SLARAAGLKR TGKSCRLRWL NYLRPDVKRG NFTADEQLLI LDLHTRWGNR WSKIAQHLPG  120
RTDNEIKNYW RTRVQKHAKQ LNCDANSKRF KDAMRYLWMP HHVDADDDHR RRLLQAQHQQ  180
HAADVAAAAA AAGGMVTSSS DSFATAESYD DVGALYDASV HAGEILVSGG GDWAQETAAN  240
QGLWPAAPDQ SAAVQAAVGG GCQFQDPELS GWVQGFSEGI TENFWALEDI WKIQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-253313624126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0697441e-179BT069744.1 Zea mays full-length cDNA clone ZM_BFb0226N11 mRNA, complete cds.
GenBankKJ7276381e-179KJ727638.1 Zea mays clone pUT5565 MYB transcription factor (MYB100) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962755.10.0PREDICTED: transcription factor MYB108-like
TrEMBLK3Z8G10.0K3Z8G1_SETIT; Uncharacterized protein
STRINGSi022831m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-74myb domain protein 112